Beta-lactamase CTX-M-1, Recombinant, E. coli, aa29-291, His-Tag (Bla)

Artikelnummer: USB-372438
Artikelname: Beta-lactamase CTX-M-1, Recombinant, E. coli, aa29-291, His-Tag (Bla)
Artikelnummer: USB-372438
Hersteller Artikelnummer: 372438
Alternativnummer: USB-372438-20,USB-372438-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins. Source: Recombinant protein corresponding to aa29-291 from E. coli bla, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~30.2kD Amino Acid Sequence: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.2
UniProt: P28585
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.