Bglap, Recombinant, Mouse, aa50-95, His-SUMO-Tag (Osteocalcin)

Artikelnummer: USB-372446
Artikelname: Bglap, Recombinant, Mouse, aa50-95, His-SUMO-Tag (Osteocalcin)
Artikelnummer: USB-372446
Hersteller Artikelnummer: 372446
Alternativnummer: USB-372446-20,USB-372446-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Source: Recombinant protein corresponding to aa50-95 from mouse Osteocalcin, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.1kD Amino Acid Sequence: YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 21.1
UniProt: P86546
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.