BID, Recombinant, Human, aa1-195, His-SUMO-Tag (BH3-interacting Domain Death Agonist)

Produktübersicht

• Artikelname: BID, Recombinant, Human, aa1-195, His-SUMO-Tag (BH3-interacting Domain Death Agonist)
• Artikelnummer: USB-372448
• Hersteller Artikelnummer: 372448
• Alternativnummer: USB-372448-20,USB-372448-100,USB-372448-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

The major proteolytic product p15 BID allows the release of cytochrome c. Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.1. Source: Recombinant protein corresponding to aa1-195 from human BID, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38kD Amino Acid Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 38
• UniProt: P55957
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.