BMF, Recombinant, Human, aa1-184, GST-Tag (Bcl-2-modifying Factor)

Artikelnummer: USB-372459
Artikelname: BMF, Recombinant, Human, aa1-184, GST-Tag (Bcl-2-modifying Factor)
Artikelnummer: USB-372459
Hersteller Artikelnummer: 372459
Alternativnummer: USB-372459-20, USB-372459-100, USB-372459-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May play a role in apoptosis. Isoform 1 seems to be the main initiator. Source: Recombinant protein corresponding to aa1-184 from human BMF, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.5kD Amino Acid Sequence: MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 47.5
UniProt: Q96LC9
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.