BMP7, Recombinant, Human, aa293-431, His-Tag (Bone Morphogenetic Protein 7)

Produktübersicht

• Artikelname: BMP7, Recombinant, Human, aa293-431, His-Tag (Bone Morphogenetic Protein 7)
• Artikelnummer: USB-372466
• Hersteller Artikelnummer: 372466
• Alternativnummer: USB-372466-20, USB-372466-100, USB-372466-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis. Source: Recombinant protein corresponding to aa293-431 from human BMP7, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.7kD Amino Acid Sequence: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 19.7
• UniProt: P18075
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.