BOLL, Recombinant, Human, aa1-283, GST-Tag (Protein Boule-like)

Artikelnummer: USB-372470
Artikelname: BOLL, Recombinant, Human, aa1-283, GST-Tag (Protein Boule-like)
Artikelnummer: USB-372470
Hersteller Artikelnummer: 372470
Alternativnummer: USB-372470-20,USB-372470-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3-UTR of mRNAs and regulating their translation. Source: Recombinant protein corresponding to aa1-283 from human BOLL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~58.3kD Amino Acid Sequence: MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 58.3
UniProt: Q8N9W6
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.