BTN3A1, Recombinant, Human, aa30-254, His-SUMO-Tag (Butyrophilin Subfamily 3 Member A1)

Artikelnummer: USB-372492
Artikelname: BTN3A1, Recombinant, Human, aa30-254, His-SUMO-Tag (Butyrophilin Subfamily 3 Member A1)
Artikelnummer: USB-372492
Hersteller Artikelnummer: 372492
Alternativnummer: USB-372492-20,USB-372492-100,USB-372492-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate. Source: Recombinant protein corresponding to aa30-254 from human BTN3A1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.14kD Amino Acid Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 40.14
UniProt: O00481
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.