BTN3A3, Recombinant, Human, aa30-248, His-Tag (Butyrophilin Subfamily 3 Member A3)

Artikelnummer: USB-372496
Artikelname: BTN3A3, Recombinant, Human, aa30-248, His-Tag (Butyrophilin Subfamily 3 Member A3)
Artikelnummer: USB-372496
Hersteller Artikelnummer: 372496
Alternativnummer: USB-372496-20,USB-372496-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role in T-cell responses in the adaptive immune response. Source: Recombinant protein corresponding to aa30-248 from human BTN3A3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.58kD Amino Acid Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.58
UniProt: O00478
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.