Angiopoietin-like Protein 8, Recombinant, Human, aa22-198, His-Tag (ANGPTL8)

Produktübersicht

• Artikelname: Angiopoietin-like Protein 8, Recombinant, Human, aa22-198, His-Tag (ANGPTL8)
• Artikelnummer: USB-372509
• Hersteller Artikelnummer: 372509
• Alternativnummer: USB-372509-20,USB-372509-100,USB-372509-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels. May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state. Source: Recombinant protein corresponding to aa22-198 from human Angiopoietin-like Protein 8, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.9kD Amino Acid Sequence: APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 23.9
• UniProt: Q6UXH0
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.