C3L, Recombinant, Vaccinia Virus, aa20-263, His-Tag (Complement Control Protein C3)

Artikelnummer: USB-372520
Artikelname: C3L, Recombinant, Vaccinia Virus, aa20-263, His-Tag (Complement Control Protein C3)
Artikelnummer: USB-372520
Hersteller Artikelnummer: 372520
Alternativnummer: USB-372520-20,USB-372520-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b. Recombinant protein corresponding to aa20-263 from Vaccinia virus Complement control protein C3, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~28.6kD Amino Acid Sequence: CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.6
UniProt: P68638
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.