Complement C5a Anaphylatoxin, Recombinant, Porcine, aa1-74, His-Tag (C5)

Artikelnummer: USB-372525
Artikelname: Complement C5a Anaphylatoxin, Recombinant, Porcine, aa1-74, His-Tag (C5)
Artikelnummer: USB-372525
Hersteller Artikelnummer: 372525
Alternativnummer: USB-372525-20, USB-372525-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation. Source: Recombinant protein corresponding to aa1-74 from full length porcine Complement C5a Anaphylatoxin, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.6kD Amino Acid Sequence: MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 10.6
UniProt: P01032
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.