CA1, Recombinant, Human, aa2-261, His-Tag (Carbonic Anhydrase 1)

Artikelnummer: USB-372528
Artikelname: CA1, Recombinant, Human, aa2-261, His-Tag (Carbonic Anhydrase 1)
Artikelnummer: USB-372528
Hersteller Artikelnummer: 372528
Alternativnummer: USB-372528-20,USB-372528-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea. Source: Recombinant protein corresponding to aa2-261 from human Carbonic Anhydrase 1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~30.7kD Amino Acid Sequence: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.7
UniProt: P00915
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.