CA8, Recombinant, Human, aa1-290, GST-Tag (Carbonic Anhydrase-related Protein)

Artikelnummer: USB-372531
Artikelname: CA8, Recombinant, Human, aa1-290, GST-Tag (Carbonic Anhydrase-related Protein)
Artikelnummer: USB-372531
Hersteller Artikelnummer: 372531
Alternativnummer: USB-372531-20,USB-372531-100,USB-372531-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Does not have a carbonic anhydrase catalytic activity. Source: Recombinant protein corresponding to aa1-290 from human CA8, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~60.0kD Amino Acid Sequence: MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 60
UniProt: P35219
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.