CALML5, Recombinant, Human, aa2-146, His-SUMO-Tag (Calmodulin-like Protein 5)

Produktübersicht

• Artikelname: CALML5, Recombinant, Human, aa2-146, His-SUMO-Tag (Calmodulin-like Protein 5)
• Artikelnummer: USB-372545
• Hersteller Artikelnummer: 372545
• Alternativnummer: USB-372545-20,USB-372545-100,USB-372545-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Binds calcium. May be involved in terminal differentiation of keratinocytes. Source: Recombinant protein corresponding to aa2-146 from human CALML5, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~31.8kD Amino Acid Sequence: AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 31.8
• UniProt: Q9NZT1
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.