Camk2n1, Recombinant, Mouse, aa1-78, His-SUMO-Tag (Calcium/Calmodulin-dependent Protein Kinase II Inhibitor 1)

Artikelnummer: USB-372554
Artikelname: Camk2n1, Recombinant, Mouse, aa1-78, His-SUMO-Tag (Calcium/Calmodulin-dependent Protein Kinase II Inhibitor 1)
Artikelnummer: USB-372554
Hersteller Artikelnummer: 372554
Alternativnummer: USB-372554-20,USB-372554-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Potent and specific inhibitor of CaM-kinase II. Source: Recombinant protein corresponding to aa1-78 from mouse Camk2n1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.51kD Amino Acid Sequence: MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 24.51
UniProt: Q6QWF9
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.