Cathepsin D, Recombinant, Cricetulus Griseus, aa65-408, His-SUMO-Tag (CTSD)

Artikelnummer: USB-372591
Artikelname: Cathepsin D, Recombinant, Cricetulus Griseus, aa65-408, His-SUMO-Tag (CTSD)
Artikelnummer: USB-372591
Hersteller Artikelnummer: 372591
Alternativnummer: USB-372591-20,USB-372591-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Partial recombinant protein corresponding to aa65-408 from Cricetulus Griseus Cathepsin D, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.3kD Amino Acid Sequence: GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 53.3
UniProt: G3I4W7
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.