CCBL1, Recombinant, Human, aa1-372, His-SUMO-Tag (Kynurenine--oxoglutarate Transaminase 1)

Artikelnummer: USB-372612
Artikelname: CCBL1, Recombinant, Human, aa1-372, His-SUMO-Tag (Kynurenine--oxoglutarate Transaminase 1)
Artikelnummer: USB-372612
Hersteller Artikelnummer: 372612
Alternativnummer: USB-372612-20,USB-372612-100,USB-372612-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Metabolizes the cysteine conjugates of certain halogenated alkenes and alkanes to form reactive metabolites. Catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond. Recombinant protein corresponding to aa1-372 from human CCBL1, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~58.6kD Amino Acid Sequence: MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 58.6
UniProt: Q16773
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol