CCDC3, Recombinant, Human, aa22-270, His-Tag (Coiled-coil Domain-containing Protein 3)

Artikelnummer: USB-372614
Artikelname: CCDC3, Recombinant, Human, aa22-270, His-Tag (Coiled-coil Domain-containing Protein 3)
Artikelnummer: USB-372614
Hersteller Artikelnummer: 372614
Alternativnummer: USB-372614-20,USB-372614-100,USB-372614-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa22-270 from human CCDC3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.1kD Amino Acid Sequence: CQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYNHLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSYFFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQEDSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLELANQKLSEKLAAGALPHINARGPVRPPYLRG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 32.1
UniProt: Q9BQI4
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.