CCL16, Recombinant, Human, aa24-120, His-SUMO-Tag (C-C Motif Chemokine 16)

Artikelnummer: USB-372620
Artikelname: CCL16, Recombinant, Human, aa24-120, His-SUMO-Tag (C-C Motif Chemokine 16)
Artikelnummer: USB-372620
Hersteller Artikelnummer: 372620
Alternativnummer: USB-372620-20, USB-372620-100, USB-372620-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES. Source: Recombinant protein corresponding to aa24-120 from human C-C Motif Chemokine 16, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.2kD Amino Acid Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.2
UniProt: O15467
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.