CCL25, Recombinant, Human, aa24-150, GST-Tag (C-C Motif Chemokine 25)

Artikelnummer: USB-372633
Artikelname: CCL25, Recombinant, Human, aa24-150, GST-Tag (C-C Motif Chemokine 25)
Artikelnummer: USB-372633
Hersteller Artikelnummer: 372633
Alternativnummer: USB-372633-20,USB-372633-100,USB-372633-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4. Source: Recombinant protein corresponding to aa24-150 from human C-C Motif Chemokine 25, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD Amino Acid Sequence: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 41.2
UniProt: O15444
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.