CD300LF, Recombinant, Human, aa20-156, His-Tag (CMRF35-like Molecule 1)

Artikelnummer: USB-372662
Artikelname: CD300LF, Recombinant, Human, aa20-156, His-Tag (CMRF35-like Molecule 1)
Artikelnummer: USB-372662
Hersteller Artikelnummer: 372662
Alternativnummer: USB-372662-20, USB-372662-100, USB-372662-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation. Source: Recombinant protein corresponding to aa20-156 from human CD300LF, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.5kD Amino Acid Sequence: TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.5
UniProt: Q8TDQ1
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.