CD300LF, Recombinant, Human, aa20-156, His-Tag (CMRF35-like Molecule 1)

Artikelnummer: USB-372663
Artikelname: CD300LF, Recombinant, Human, aa20-156, His-Tag (CMRF35-like Molecule 1)
Artikelnummer: USB-372663
Hersteller Artikelnummer: 372663
Alternativnummer: USB-372663-20, USB-372663-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation. Partial recombinant protein corresponding to aa20-156 from human CMRF35-like Molecule 1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.5kD Amino Acid Sequence: TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.5
UniProt: Q8TDQ1
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.