CD40LG, Recombinant, Rabbit, aa113-261, His-Tag (CD40 Ligand)

Artikelnummer: USB-372673
Artikelname: CD40LG, Recombinant, Rabbit, aa113-261, His-Tag (CD40 Ligand)
Artikelnummer: USB-372673
Hersteller Artikelnummer: 372673
Alternativnummer: USB-372673-20,USB-372673-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching. Source: Recombinant protein corresponding to aa113-261 from rabbit CD40LG, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~18.2kD Amino Acid Sequence: MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.2
UniProt: G1SKP7
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.