CD74, Recombinant, Rat, aa57-280, His-Tag (H-2 Class II Histocompatibility Antigen gamma Chain)

Produktübersicht

• Artikelname: CD74, Recombinant, Rat, aa57-280, His-Tag (H-2 Class II Histocompatibility Antigen gamma Chain)
• Artikelnummer: USB-372683
• Hersteller Artikelnummer: 372683
• Alternativnummer: USB-372683-20,USB-372683-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. Source: Recombinant protein corresponding to aa57-280 from rat CD74, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.5kD Amino Acid Sequence: QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 29.5
• UniProt: P10247
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.