CD82, Recombinant, Mouse, aa111-227, His-SUMO-Tag

Artikelnummer: USB-372687
Artikelname: CD82, Recombinant, Mouse, aa111-227, His-SUMO-Tag
Artikelnummer: USB-372687
Hersteller Artikelnummer: 372687
Alternativnummer: USB-372687-20,USB-372687-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway. Source: Recombinant protein corresponding to aa111-227 from mouse CD82, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.5kD Amino Acid Sequence: DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29.5
UniProt: P40237
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.