CDC48, Recombinant, Glycine Max, aa653-807, His-SUMO-Tag (Cell Division Cycle Protein 48 Homolog)

Artikelnummer: USB-372694
Artikelname: CDC48, Recombinant, Glycine Max, aa653-807, His-SUMO-Tag (Cell Division Cycle Protein 48 Homolog)
Artikelnummer: USB-372694
Hersteller Artikelnummer: 372694
Alternativnummer: USB-372694-20, USB-372694-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Probably functions in cell division and growth processes. Source: Recombinant protein corresponding to aa653-807 from glycine max CDC48, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~33.5kD Amino Acid Sequence: DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.5
UniProt: P54774
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.