CDH-1, Recombinant, Phanerochaete Chrysosporium, aa19-208, His-SUMO-Tag (Cellobiose Dehydrogenase)

Artikelnummer: USB-372695
Artikelname: CDH-1, Recombinant, Phanerochaete Chrysosporium, aa19-208, His-SUMO-Tag (Cellobiose Dehydrogenase)
Artikelnummer: USB-372695
Hersteller Artikelnummer: 372695
Alternativnummer: USB-372695-20,USB-372695-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone. Source: Recombinant protein corresponding to aa19-208 from phanerochaete chrysosporium CDR-1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~36.3kD Amino Acid Sequence: QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36.3
UniProt: Q01738
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.