CDH-1, Recombinant, White-rot Fungus, aa19-208, His-Tag (Cellobiose Dehydrogenase)

Artikelnummer: USB-372696
Artikelname: CDH-1, Recombinant, White-rot Fungus, aa19-208, His-Tag (Cellobiose Dehydrogenase)
Artikelnummer: USB-372696
Hersteller Artikelnummer: 372696
Alternativnummer: USB-372696-20,USB-372696-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone. Source: Recombinant protein corresponding to aa19-208 from white-rot fungus CDH-1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~22.3kD Amino Acid Sequence: QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 22.3
UniProt: Q01738
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.