CDK2AP1, Recombinant, Human, aa1-115, GST-Tag (Cyclin-dependent Kinase 2-associated Protein 1)
Artikelnummer:
USB-372699
Hersteller Artikelnummer:
372699
Alternativnummer:
USB-372699-20, USB-372699-100, USB-372699-1
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Specific inhibitor of the cell-cycle kinase CDK2. Source: Recombinant protein corresponding to aa1-115 from human CDK2AP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.4kD Amino Acid Sequence: MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten