CDKN2AIPNL, Recombinant, Human, aa1-116, His-Tag (CDKN2AIP N-terminal-like Protein)

Artikelnummer: USB-372704
Artikelname: CDKN2AIPNL, Recombinant, Human, aa1-116, His-Tag (CDKN2AIP N-terminal-like Protein)
Artikelnummer: USB-372704
Hersteller Artikelnummer: 372704
Alternativnummer: USB-372704-20,USB-372704-100,USB-372704-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-116 from human CDKN2AIPNL, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~17.2kD Amino Acid Sequence: MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.2
UniProt: Q96HQ2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.