CEACAM4, Recombinant, Human, aa36-155, His-Tag (Carcinoembryonic Antigen-related Cell Adhesion Molecule 4)

Artikelnummer: USB-372710
Artikelname: CEACAM4, Recombinant, Human, aa36-155, His-Tag (Carcinoembryonic Antigen-related Cell Adhesion Molecule 4)
Artikelnummer: USB-372710
Hersteller Artikelnummer: 372710
Alternativnummer: USB-372710-20,USB-372710-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. Source: Recombinant protein corresponding to aa36-155 from human CEACAM4, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.6kD Amino Acid Sequence: FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 14.6
UniProt: O75871
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.