CEBPG, Recombinant, Human, aa1-148, His-Tag (CCAAT/Enhancer-binding Protein gamma)

Artikelnummer: USB-372712
Artikelname: CEBPG, Recombinant, Human, aa1-148, His-Tag (CCAAT/Enhancer-binding Protein gamma)
Artikelnummer: USB-372712
Hersteller Artikelnummer: 372712
Alternativnummer: USB-372712-20, USB-372712-100, USB-372712-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcription factor that binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Might change the DNA-binding specificity of other transcription factors and recruit them to unusual DNA sites. Recombinant protein corresponding to aa1-148 from human CEBPG, fused to 6X His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.2kD Amino Acid Sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 20.2
UniProt: P53567
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.