Cela2a, Recombinant, Mouse, aa31-271, His-Tag (Chymotrypsin-like Elastase Family Member 2A)

Artikelnummer: USB-372717
Artikelname: Cela2a, Recombinant, Mouse, aa31-271, His-Tag (Chymotrypsin-like Elastase Family Member 2A)
Artikelnummer: USB-372717
Hersteller Artikelnummer: 372717
Alternativnummer: USB-372717-20,USB-372717-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Acts upon elastin. Recombinant protein corresponding to aa31-271 from mouse Cela2a, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.69kD Amino Acid Sequence: VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.69
UniProt: P05208
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.