CETN1, Recombinant, Human, aa1-172, GST-Tag (Centrin-1)

Artikelnummer: USB-372727
Artikelname: CETN1, Recombinant, Human, aa1-172, GST-Tag (Centrin-1)
Artikelnummer: USB-372727
Hersteller Artikelnummer: 372727
Alternativnummer: USB-372727-20,USB-372727-100,USB-372727-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a fundamental role in microtubule-organizing center structure and function. Recombinant protein corresponding to aa1-172 from human CETN1, fused to GST-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: Q12798 Molecular Weight: ~46.6kD Amino Acid Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 46.6
UniProt: Q12798
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.