CETN3, Recombinant, Human, aa1-167, GST-Tag (Centrin-3)

Artikelnummer: USB-372728
Artikelname: CETN3, Recombinant, Human, aa1-167, GST-Tag (Centrin-3)
Artikelnummer: USB-372728
Hersteller Artikelnummer: 372728
Alternativnummer: USB-372728-20,USB-372728-100,USB-372728-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a fundamental role in microtubule-organizing center structure and function. Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, DSS1, and either centrin CETN2 or CETN3. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. Source: Recombinant protein corresponding to aa1-167 from human CETN3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.5kD Amino Acid Sequence: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 46.5
UniProt: O15182
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.