CFDP1, Recombinant, Human, aa1-299, GST-Tag (Craniofacial Development Protein 1)

Produktübersicht

• Artikelname: CFDP1, Recombinant, Human, aa1-299, GST-Tag (Craniofacial Development Protein 1)
• Artikelnummer: USB-372733
• Hersteller Artikelnummer: 372733
• Alternativnummer: USB-372733-20,USB-372733-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May play a role during embryogenesis. Source: Recombinant protein corresponding to aa1-299 from human CFDP1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~60.6kD Amino Acid Sequence: MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 60.6
• UniProt: Q9UEE9
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.