CHD1L, Recombinant, Human, aa704-897, His-SUMO-Tag (Chromodomain-helicase-DNA-binding Protein 1-like, Amplified in Liver Cancer Protein 1)

Artikelnummer: USB-372742
Artikelname: CHD1L, Recombinant, Human, aa704-897, His-SUMO-Tag (Chromodomain-helicase-DNA-binding Protein 1-like, Amplified in Liver Cancer Protein 1)
Artikelnummer: USB-372742
Hersteller Artikelnummer: 372742
Alternativnummer: USB-372742-20,USB-372742-100
Hersteller: US Biological
Kategorie: Molekularbiologie
DNA helicase which plays a role in chromatin-remodeling following DNA damage. Targeted to sites of DNA damage through interaction with poly(ADP-ribose) and functions to regulate chromatin during DNA repair. Able to catalyze nucleosome sliding in an ATP-dependent manner. Helicase activity is strongly stimulated upon poly(ADP-ribose)-binding. Source: Partial recombinant protein corresponding to aa704-897 from human CHD1L, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~37.3kD Amino Acid Sequence: SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 37.3
UniProt: Q86WJ1
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.