CHIC2, Recombinant, Human, aa1-165, GST-Tag (Cysteine-rich Hydrophobic Domain 2 Protein)

Artikelnummer: USB-372747
Artikelname: CHIC2, Recombinant, Human, aa1-165, GST-Tag (Cysteine-rich Hydrophobic Domain 2 Protein)
Artikelnummer: USB-372747
Hersteller Artikelnummer: 372747
Alternativnummer: USB-372747-20,USB-372747-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-165 from human CHIC2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.3kD Amino Acid Sequence: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 46.3
UniProt: Q9UKJ5
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.