Chrna1, Recombinant, Mouse, aa21-230, His-Tag (Acetylcholine Receptor Subunit alpha)

Artikelnummer: USB-372764
Artikelname: Chrna1, Recombinant, Mouse, aa21-230, His-Tag (Acetylcholine Receptor Subunit alpha)
Artikelnummer: USB-372764
Hersteller Artikelnummer: 372764
Alternativnummer: USB-372764-20,USB-372764-100
Hersteller: US Biological
Kategorie: Molekularbiologie
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Source: Recombinant protein corresponding to aa21-230 from mouse Chrna1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.5kD Amino Acid Sequence: SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.5
UniProt: P04756
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.