CIAO1, Recombinant, Human, aa1-339, His-SUMO-Tag (Probable Cytosolic Iron-sulfur Protein Assembly Protein CIAO1)

Produktübersicht

• Artikelname: CIAO1, Recombinant, Human, aa1-339, His-SUMO-Tag (Probable Cytosolic Iron-sulfur Protein Assembly Protein CIAO1)
• Artikelnummer: USB-372772
• Hersteller Artikelnummer: 372772
• Alternativnummer: USB-372772-20,USB-372772-100,USB-372772-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation. Source: Recombinant protein corresponding to aa1-339 from human CIAO1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.8kD Amino Acid Sequence: MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 53.8
• UniProt: O76071
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.