Clec4a, Recombinant, Mouse, aa70-238, His-SUMO-Tag, Myc-Tag (C-type Lectin Domain Family 4 Member A, C-type Lectin Superfamily Member 6, Dendritic Cell Immunoreceptor)

Artikelnummer: USB-372782
Artikelname: Clec4a, Recombinant, Mouse, aa70-238, His-SUMO-Tag, Myc-Tag (C-type Lectin Domain Family 4 Member A, C-type Lectin Superfamily Member 6, Dendritic Cell Immunoreceptor)
Artikelnummer: USB-372782
Hersteller Artikelnummer: 372782
Alternativnummer: USB-372782-20,USB-372782-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. Source: Partial recombinant protein corresponding to aa70-238 from mouse Clec4a, fused to 10xHis-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~39.6kD Amino Acid Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.6
UniProt: Q9QZ15
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.