COL4A3, Recombinant, Human, aa1446-1667, His-Tag (Collagen alpha-3(IV) Chain)

Artikelnummer: USB-372828
Artikelname: COL4A3, Recombinant, Human, aa1446-1667, His-Tag (Collagen alpha-3(IV) Chain)
Artikelnummer: USB-372828
Hersteller Artikelnummer: 372828
Alternativnummer: USB-372828-20,USB-372828-100,USB-372828-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Type IV collagen is the major structural component of glomerular basent membranes (GBM), forming a chicken-wire meshwork together with laminins, proteoglycans and entactin/nidogen. Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity, these two anti-tumor properties may be regulated via RGD-independent ITGB3-mediated mechanisms. Source: Recombinant protein corresponding to aa1446-1667 from human COL4A3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.5kD Amino Acid Sequence: FVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.5
UniProt: Q01955
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.