Complement Receptor Type 2, Recombinant, Mouse, aa729-963, His-Tag (Cr2)

Produktübersicht

• Artikelname: Complement Receptor Type 2, Recombinant, Mouse, aa729-963, His-Tag (Cr2)
• Artikelnummer: USB-372839
• Hersteller Artikelnummer: 372839
• Alternativnummer: USB-372839-20,USB-372839-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Receptor for complement C3d. Participates in B lymphocytes activation. Source: Recombinant protein corresponding to aa729-963 from mouse Complement Receptor Type 2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~28.0kD Amino Acid Sequence: LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 28
• UniProt: P19070
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.