Conglutin-7, Recombinant, Arachis Hypogaea, aa22-172, His-Tag

Artikelnummer: USB-372840
Artikelname: Conglutin-7, Recombinant, Arachis Hypogaea, aa22-172, His-Tag
Artikelnummer: USB-372840
Hersteller Artikelnummer: 372840
Alternativnummer: USB-372840-20,USB-372840-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Weak inhibitor of trypsin. Source: Recombinant protein corresponding to aa22-172 from arachis hypogaea Conglutin-7, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.0kD Amino Acid Sequence: RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 22
UniProt: Q6PSU2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.