COX4I1, Recombinant, Human, aa23-169, His-SUMO-Tag (Cytochrome C Oxidase Subunit 4 Isoform 1, Mitochondrial)

Artikelnummer: USB-372849
Artikelname: COX4I1, Recombinant, Human, aa23-169, His-SUMO-Tag (Cytochrome C Oxidase Subunit 4 Isoform 1, Mitochondrial)
Artikelnummer: USB-372849
Hersteller Artikelnummer: 372849
Alternativnummer: USB-372849-20,USB-372849-100,USB-372849-1
Hersteller: US Biological
Kategorie: Molekularbiologie
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Recombinant protein corresponding to aa23-169 from human COX4I1, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.2kD Amino Acid Sequence: AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.2
UniProt: P13073
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.