COX7A2L, Recombinant, Human, aa1-114, GST-Tag (Cytochrome c Oxidase Subunit 7A-related Protein, Mitochondrial)

Artikelnummer: USB-372851
Artikelname: COX7A2L, Recombinant, Human, aa1-114, GST-Tag (Cytochrome c Oxidase Subunit 7A-related Protein, Mitochondrial)
Artikelnummer: USB-372851
Hersteller Artikelnummer: 372851
Alternativnummer: USB-372851-20,USB-372851-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in the regulation of oxidative phosphorylation and energy metabolism. Necessary for the assembly of mitochondrial respiratory supercomplex. Source: Recombinant protein corresponding to aa1-114 from human COX7A2L, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.6kD Amino Acid Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.6
UniProt: O14548
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.