CRIP2, Recombinant, Human, aa1-208, His-SUMO-Tag (Cysteine-rich Protein 2)

Artikelnummer: USB-372867
Artikelname: CRIP2, Recombinant, Human, aa1-208, His-SUMO-Tag (Cysteine-rich Protein 2)
Artikelnummer: USB-372867
Hersteller Artikelnummer: 372867
Alternativnummer: USB-372867-20,USB-372867-100,USB-372867-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-208 from human Cysteine-rich Protein 2 fused to His-SUMO-Tag at N-temrinal at N-terminal expressed in E. coli. Molecular Weight: ~38.5kD Amino Acid Sequence: MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38.5
UniProt: P52943
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.