CS6 Fimbrial Subunit B, Recombinant, E. coli, aa22-167, His-Tag (CssB)

Produktübersicht

• Artikelname: CS6 Fimbrial Subunit B, Recombinant, E. coli, aa22-167, His-Tag (CssB)
• Artikelnummer: USB-372875
• Hersteller Artikelnummer: 372875
• Alternativnummer: USB-372875-20,USB-372875-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa22-167 from E. coli CS6 Fimbrial Subunit B, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.9kD Amino Acid Sequence: GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 17.9
• UniProt: P53510
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.