CST9, Recombinant, Human, aa29-159, His-Tag (Cystatin-9)

Artikelnummer: USB-372894
Artikelname: CST9, Recombinant, Human, aa29-159, His-Tag (Cystatin-9)
Artikelnummer: USB-372894
Hersteller Artikelnummer: 372894
Alternativnummer: USB-372894-20,USB-372894-100,USB-372894-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May be involved in testis development (By similarity). May play a role in hematopoietic differentiation or inflammation (PubMed:12535658). Has immunomodulatory and antimicrobial functions against Francisella tularensis, a Gram-negative bacteria (PubMed:23922243). Source: Recombinant protein corresponding to aa29-159 from human CST9, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.9kD Amino Acid Sequence: WCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.9
UniProt: Q5W186
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.