CTNNBIP1, Recombinant, Human, aa1-81, GST-Tag (Beta-catenin-interacting Protein 1)

Artikelnummer: USB-372906
Artikelname: CTNNBIP1, Recombinant, Human, aa1-81, GST-Tag (Beta-catenin-interacting Protein 1)
Artikelnummer: USB-372906
Hersteller Artikelnummer: 372906
Alternativnummer: USB-372906-20,USB-372906-100,USB-372906-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway. Source: Recombinant protein corresponding to aa1-81 from human CTNNBIP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.2kD Amino Acid Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36.2
UniProt: Q9NSA3
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.